Usbio/WDR5 (WD Repeat Domain 5, BIG-3, SWD3) (AP)/100ul/253434-AP

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq.||Applications: |Suitable for use in ELISA. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|QPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK||Storage and Stability:|Store product at 4°C. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note:|Applications are based on unconjugated antibody.||Note: Applications are based on unconjugated antibody.Product Type:Mab|Isotype: IgG2a,k|Clone No: 1B1|Host: mouse|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phophatase (AP).|Purity: Purified|Immunogen: WDR5 (NP_060058, 16aa-120aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes WDR5.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.