Description | Fox3 is one of a family of mammalian homologues of Fox-1. The Fox proteins are about 46kDa in size, and each includes a central highly conserved RRM type RNA recognition motif. Much interest has focused on Fox3 as a result of the recent finding that this protein corresponds to NeuN, a neuronal nuclear antigen. NeuN/Fox-3 has a function in RNA splicing and is expressed heavily and specifically in neuronal nuclei and cytoplasm. Our antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli. We did not use full length Fox3 as immunogen since the three mammalian Fox homologues, namely Fox1, Fox2 and Fox3, include virtually identical RRM motifs. The N-terminal region of the three molecules are much more variable in the three molecules so antibodies specific for each of the three molecules can therefore be generated. |
Batch No. | See product label |
Unit size | 100 µL |
Antigen | Antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli. |
Sequence | MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGS EASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR |
Antigen Location | 1-99 |
Antigen Length | 100 |
Antibody Type | Monoclonal |
Isotype | IgG2a |
Clone | 1B7 |
Other Names | Feminizing locus on X; Fox-1; Fox3; NeuN; |
Accession | A6NFN3 FOX1C_HUMAN; |
Produced in | Mouse |
Applications | Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:500 - 1:1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user. |
Specificity | The specificity of this antibody has been confirmed by WB. Two alternate transcripts can be seen at 46 kDa and 48 kDa. |
Antibody Against | NeuN/Fox3 |
Cross-reactivity | Hu, Rat, Ms, Bov, Porcine |
Blast URL | Click here |
Form | Lyophilised with 5% trehalose, without preservatives. |
Appearance | White powder |
Reconstitution | Reconstitute in sterile distilled water. Centrifuge to remove any insoluble material. |
Storage | After reconstitution of lyophilised antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles. |
Expiry Date | 12 months after purchase |
Specific References | Hamanoue M et al., (2016) "Cell-permeable p38 MAP kinase promotes migration of adult neural stem/progenitor cells" Sci Rep. 6:24279. Application: Western Blotting. Species: Mouse Han YC et al., (2016) "Direct Reprogramming of Mouse Fibroblasts to Neural Stem Cells by Small Molecules" Stem Cells Int. 2016; 2016:4304916. Application: IF. Species: Mouse Han YC & Zhou XF, (2015) "Method of producing multipotent stem cells" US 20150322405 A1 (patent). Application: IF. Species: Human |
SouthernBiotech/Goat Anti-Human Lambda-Alexa Fluor® 555/2070-32/1.0 mg
vectorlabs/Biotinylated Aleuria Aurantia Lectin (AAL)/B-1395/1 mg
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Mouse IgG)/PK-6102/1 kit
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Universal)/PK-6200/1 kit
vectorlabs/Unconjugated Musa Paradisiaca (Banana) Lectin (BanLec)/L-1410/5 mg
GiottoBiotech/Calmodulin N60D/5 mg/G02CLM60cn