LL-37 | Unit size | Cat. code | Docs | Price |
---|---|---|---|---|
Antimicrobial peptide | 1 mg | tlrl-l37 | TDSMSDS | Please contact our distributor Add to favorite |
LL-37, also known as hCAP18, is the C-terminal part of the only human cathelicidin identified to date called human cationic antimicrobial protein (hCAP).
LL-37 exhibits a variety of immunomodulatory functions such as bactericidal action, chemotaxis, activation of chemokine secretion and antisepsis effect [1].The synthetic LL-37 peptide has been shown to suppress the inflammatory response induced by LPS and other TLR ligands [2].
References:
1. Scott MG. et al., 2002. The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses. J Immunol. 169(7):3883-91.2. Mookherjee N. et al., 2006. Modulation of theTLR-mediated inflammatory response by the endogenous human host defense peptide LL-37. J Immunol. 176(4):2455-64.
Back to the topWorking concentration: 1 -50 µg/ml
Solubility: Water (1 mg/ml)
Amino acid sequence: [LL-37, 37 aa]
Molecular formula: C205H340N60O35
Molecular weight: 4493.37
Purity: ≥ 95 % (UHPLC)
Back to the topLL-37 is provided lyophilized.
LL-37 is shipped at room temperature.
Store at -20°C.
Lyophilized product is stable 6 months when properly stored.
Back to the top2020 J Invest Dermatol. DOI: 10.1016/j.jid.2019.09.029
Kopfnagel V. et al.
2020 Nat Commun. DOI: 10.1038/s41467-019-13756-4
Herster F. et al.
2019 Sci Rep.DOI: 10.1038/s41598-019-42751-4
Simonin J. et al.
2019 Pathogens. DOI: 10.3390/pathogens8010031.
Sharma P. et al.
2019 Viruses DOI: 10.3390/v11010077.
Roy M. et al.
2019 Antiviral Res. DOI: 10.1016/j.antiviral.2018.07.025
Brice D.C. et al.
2017 Dermatol Ther (Heidelb). DOI: 10.1007/s13555-017-0176-3
Thibaut de Ménonville S. et al.
Load moreTLR4 Agonist - Lipopolysaccharide from E. coli 0111:B4
Poly(I:C) HMWHigh molecular weight Polyinosine-polycytidylic acid
SouthernBiotech/Goat Anti-Human Lambda-Alexa Fluor® 555/2070-32/1.0 mg
vectorlabs/Biotinylated Aleuria Aurantia Lectin (AAL)/B-1395/1 mg
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Mouse IgG)/PK-6102/1 kit
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Universal)/PK-6200/1 kit
vectorlabs/Unconjugated Musa Paradisiaca (Banana) Lectin (BanLec)/L-1410/5 mg
GiottoBiotech/Calmodulin N60D/5 mg/G02CLM60cn