企业QQ
官方微信
| Product Name | Beta - Amyloid (1 - 40), HiLyteᵀᴹFluor 488 - labeled, HumanHiLyte Fluor 488 - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Size | 0.1 mg |
| Catalog # | AS-60491-01 |
| US$ | $231 |
| Purity | % Peak Area By HPLC ≥ 95% |
This is a fluorescent (HiLyte Fluor 488)-labeled ß-Amyloid peptide, Abs/Em=503/528 nm. Solvent Information | |
| Detailed Information |  Datasheet Material Safety Data Sheets (MSDS) |
| Storage | -20°C |
| Molecular Weight | 4686.3 |
| HiLyte Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV | |
| Sequence(Three-Letter Code) | Hilyte Fluor 488 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH |
| Product Citations | Condello, C. et al. (2015). Microglia constitute a barrier that prevents neurotoxic protofibrillar Aβ42 hotspots around plaques. Nat Commun doi:10.1038/ncomms7176.Hawkes, CA. et al. (2015). Prenatal high‐fat diet alters the cerebrovasculature and clearance of β‐amyloid in adult offspring. J Pathol 235, 619. doi: 10.1002/path.4468.Caglayan, S. et al. (2014). Lysosomal sorting of Amyloid-β by the SORLA Receptor is impaired by a familial Alzheimers Disease mutation. Sci Transl Med 6, 223ra20. doi: 10.1126/scitranslmed.3007747.Esbjörner, EK. et al. (2014). Direct observations of Amyloid β self-assembly in live cells provide insights into differences in the kinetics of Aβ (140) and Aβ (142) aggregation. ChemistryBiol 21, 732. doi:10.1016/j.chembiol.2014.03.014.Carlo, A-S. et al. (2013). The pro-neurotrophin receptor Sortilin is a major neuronal apolipoprotein E receptor for catabolism of amyloid-β peptide in the brain. J Neurosci 33, 358. doi: 10.1523/JNEUROSCI.2425-12.2013.Abdul-Hay, SO. et al. (2012). Identification of BACE2 as an avid ß-amyloid-degrading protease. Mol Neurodegener 7, 46.Anderson, VL. & WW. Webb (2011). Transmission electron microscopy characterization of fluorescently labelled amyloid β 1-40 and α-synuclein aggregates. BMC Biotechnol 11, 125. doi:10.1186/1472-6750-11-125.Hamada, T. (2010). Biomimetic Microdroplet Membrane Interface: Detection of the Lateral Localization of Amyloid Beta Peptides. J Phys Chem Lett 1, 170. doi: 10.1021/jz900106z.Ding, H. et al. (2009). Determination of the Oligomer Size of Amyloidogenic Protein β-Amyloid(140) by Single-Molecule Spectroscopy. Biophys J 97, 912. doi: 10.1016/j.bpj.2009.05.035.Meier, M. et al. (2009). Plug-based microfluidics with defined surface chemistry to miniaturize and control aggregation of amyloidogenic peptides. Angew Chem Int Ed 48, 1. doi: 10.1002/anie.200805225.Morita, M. et al. (2009). Real-time observation of model membrane dynamics induced by Alzheimer"s amyloid beta. Biophys Chem 147, 81. doi: 10.1016/j.bpc.2009.12.004.Petersen, CAH. et al. (2008). The amyloid β-peptide is imported into mitochondria via the TOM import machinery and localized to mitochondrial cristae. PNAS 105, 13145. doi: 10.1073/pnas.0806192105. |
SouthernBiotech/Goat Anti-Human Lambda-Alexa Fluor® 555/2070-32/1.0 mg
vectorlabs/Biotinylated Aleuria Aurantia Lectin (AAL)/B-1395/1 mg
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Mouse IgG)/PK-6102/1 kit
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Universal)/PK-6200/1 kit
vectorlabs/Unconjugated Musa Paradisiaca (Banana) Lectin (BanLec)/L-1410/5 mg
GiottoBiotech/Calmodulin N60D/5 mg/G02CLM60cn