企业QQ
官方微信
| Name | Apelin 12 FRET bundle | ||||||
| Description | For a Fluorescence Resonance Energy Transfer (FRET) application, this pair contains the FRET peptide and its control . The amount states the amount delivered of each of the two peptides. The individual peptides of this set are also available separately. | ||||||
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 1 mg | SP-5200-1 | 410 EUR | BUY | ||||
| 5 mg | SP-5200-5 | 1670 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
| Name | |||||||
|---|---|---|---|---|---|---|---|
| Apelin 12 FRET | |||||||
| Apelin 12 FRET control | |||||||
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
SouthernBiotech/Goat Anti-Human Lambda-Alexa Fluor® 555/2070-32/1.0 mg
vectorlabs/Biotinylated Aleuria Aurantia Lectin (AAL)/B-1395/1 mg
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Mouse IgG)/PK-6102/1 kit
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Universal)/PK-6200/1 kit
vectorlabs/Unconjugated Musa Paradisiaca (Banana) Lectin (BanLec)/L-1410/5 mg
GiottoBiotech/Calmodulin N60D/5 mg/G02CLM60cn