Name | Apelin 12, human | ||||||
Sequence | RPRLSHKGPMPF | ||||||
3-letter-code | Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe | ||||||
Molecular weight | 1422.72 | ||||||
Counter ion | TFA | ||||||
Description | Apelin, which is encoded by the APLN gene, is the endogenous ligand for the G-protein-coupled APJ receptor. It is widely expressed in various organs such as the heart, lung, kidney, liver, adipose tissue, gastrointestinal tract, brain, adrenal glands, endothelium, and human plasma. The apelin pre-proprotein peptide potentially gives rise to several active fragments. Apelin 12 is a 12 amino acid peptide fragment corresponding to the sequence 62-77. It is also found in bovine, rat, and mouse. | ||||||
Amount | Cat.No. | Unit price | |||||
---|---|---|---|---|---|---|---|
1 mg | SP-5121-1 | 75 EUR | BUY | ||||
5 mg | SP-5121-5 | 290 EUR | BUY | ||||
For larger amounts please inquire. |
Name | |||||||
---|---|---|---|---|---|---|---|
Apelin 12 FRET bundle | |||||||
Apelin 12, 1-10, D5 | Ser 5 is replaced by Aspartic acid (Asp). Missing the two C-terminal amino acids Pro Phe of Apelin 12. | ||||||
Apelin 12, 1-10, I4 | Leu 4 is replaced by Isoleucine (Ile). Missing the two C-terminal amino acids Pro Phe of Apelin 12. | ||||||
Apelin 12, 1-10, K3 | Arg 3 is replaced by Lysine (Lys). Missing the two C-terminal amino acids Pro Phe of Apelin 12. | ||||||
Apelin 12, 1-10, K3, D5 | Arg 3 is replaced by Lysine (Lys), Ser 5 is replaced by Aspartic acid (Asp). Missing the two C-terminal amino acids Pro Phe of Apelin 12. | ||||||
Apelin 12, 1-10, K6 | His 6 is replaced by Lysine (Lys). Missing the two C-terminal amino acids Pro Phe of Apelin 12. |
Name | Sequence | ||||||
---|---|---|---|---|---|---|---|
Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF | ||||||
Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
SouthernBiotech/Goat Anti-Human Lambda-Alexa Fluor® 555/2070-32/1.0 mg
vectorlabs/Biotinylated Aleuria Aurantia Lectin (AAL)/B-1395/1 mg
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Mouse IgG)/PK-6102/1 kit
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Universal)/PK-6200/1 kit
vectorlabs/Unconjugated Musa Paradisiaca (Banana) Lectin (BanLec)/L-1410/5 mg
GiottoBiotech/Calmodulin N60D/5 mg/G02CLM60cn