企业QQ
官方微信
| Name | Apelin 13, Pyr1, 13C/15N, 6dS | ||||||
| Sequence | (Pyr)RP*RL(dS)HKGPMP*F | ||||||
| 3-letter-code | Pyr - Arg - Pro* - Arg - Leu - d - Ser - His - Lys - Gly - Pro - Met - Pro* - Phe | ||||||
| Notes | Pro 3 and Pro 12 are labelled with the stable isotopes 13C/15N, adding a total of 12 Da to the molecular weight of the peptide. D-form of Ser 6. | ||||||
| Molecular weight | 1545.93 | ||||||
| Amount | Cat.No. | Unit price | |||||
|---|---|---|---|---|---|---|---|
| 0.1 mg | SP-5198-01 | 340 EUR | BUY | ||||
| 0.5 mg | SP-5198-05 | 670 EUR | BUY | ||||
| 1 mg | SP-5198-1 | 840 EUR | BUY | ||||
| For larger amounts please inquire. | |||||||
| Name | Sequence | ||||||
|---|---|---|---|---|---|---|---|
| Apelin 12, human | RPRLSHKGPMPF | ||||||
| Apelin 17, human | KFRRQRPRLSHKGPMPF | ||||||
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF | ||||||
SouthernBiotech/Goat Anti-Human Lambda-Alexa Fluor® 555/2070-32/1.0 mg
vectorlabs/Biotinylated Aleuria Aurantia Lectin (AAL)/B-1395/1 mg
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Mouse IgG)/PK-6102/1 kit
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Universal)/PK-6200/1 kit
vectorlabs/Unconjugated Musa Paradisiaca (Banana) Lectin (BanLec)/L-1410/5 mg
GiottoBiotech/Calmodulin N60D/5 mg/G02CLM60cn