Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It also helps restore the body’s salt and water balance and improves heart function.
B-type Natriuretic Peptide (BNP) human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The protein was lyophilized without additives. Purity is greater than 98.0% as determined by RP-HPLC and SDS-PAGE.
Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH.
SouthernBiotech/Goat Anti-Human Lambda-Alexa Fluor® 555/2070-32/1.0 mg
vectorlabs/Biotinylated Aleuria Aurantia Lectin (AAL)/B-1395/1 mg
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Mouse IgG)/PK-6102/1 kit
vectorlabs/VECTASTAIN® Elite® ABC-HRP Kit (Peroxidase, Universal)/PK-6200/1 kit
vectorlabs/Unconjugated Musa Paradisiaca (Banana) Lectin (BanLec)/L-1410/5 mg
GiottoBiotech/Calmodulin N60D/5 mg/G02CLM60cn