QED Bioscience/Recombinant CCL3 (MIP1α)/50187P10/1 Ea

Catalog No. Size #1112 Anti-Human CCR5 Antibody 50187P-2 2ug

50187P-10 10ug

50187P-50 50ug

50187P-100 100ug

50187P-1000 1000ug

CCL3, also known as Macrophage Inflammatory Protein-1α (MIP-1α), is a proinflammatory chemokine that stimulates chemotaxis and activation of different cell populations of the immune system. CCL3 binds to CCR1, CCR4, and CCR5 receptors, and it is one of the major HIV- suppressive factors produced by CD8+ T-cells. CCL3 induces dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).

Source: Recombinant human CCL3 is produced in E. coli (accession no.

P10147).

Protein Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQV CADPSEEWVQKYVSDLELSA

Molecular Mass: 7.716kDa by Mass Spec.

Purity: >97% by SDS-PAGE

Activity: EC50 = 0.2nM determined by migration of recombinant CCR5- expressing cells.

Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.

Form: Lyophilized.

Carrier Protein: None.

Reconstitution: Recommended at 100ug/ml in sterile distilled water.

Stability and Storage: 12 months from date of receipt, -20oC to -70oC, as supplied.

1 month, 2oC to 8oC, under sterile conditions after reconstitution.

3 months, -20oC to -70oC, under sterile conditions after reconstitution.

For in vitro investigational use only. Not for use in diagnostic or therapeutic procedures.