Bpsbioscience/Human Insulin/90202B/100 mg

Recombinant human Insulin is a disulfide-linked homodimeric protein consisting of 51 amino acid residues, and migrates as an approximately 6 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Insulin mature chain was expressed in E. coli.

P01308

≥95% by SDS-PAGE and HPLC

<0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

30 IU/mg

Lyophilized from a 0.2 µm filtered aqueous solution with no additives

lyophilized protein

Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

1. Ikeya, T., et al., Proc R Soc B. Nov 2009,276:3799-3807.
2. Smith, R., et al., Hum. Mol. Genet., Oct 2009,18:3942-3954.
3. Liu, H., et al., J Biol Chem., Oct 2009,284:27090-27100

Avoid freeze/thaw cycles

GIVEQCCTSICSLYQLENYCN (chain a) and FVNQHLCGSHLVEALYLVCGERGFFYTPKT (chain b)

Cytokine/Growth Factors

Recombinant Protein