Sclerostin, also known as SOST, is a member of the Cerberus/DAN family of BMP antagonists. SOST is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain. It shows sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. SOST is produced by the osteocyte and has anti-anabolic effects on bone formation. It is a negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.
| Source | HEK293 |
| Names | SOST, UNQ2976, PRO7455, PRO7476 |
| Accession # | Q9BQB4 |
| Formulation | Supplied as a 0.2 μM filtered solution of 20mM Tris, 250mM NaCl, pH 8.0 |
| Shipping | The product is shipped on dry ice/ice packs. |
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Purity | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence | QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRY VTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEA PRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAYHHHHH H |