Programmed cell death protein 1(PDCD1) is a single-pass type I membrane protein and contains 1 Ig-like V-type domain. PD-1 is a member of the extended CD28/CTLA-4 family of T cell regulators. PDCD1 inhibits the T-cell proliferation and production of related cytokines including IL-1, IL-4, IL-10 and IFN-γ by suppressing the activation and transduction of PI3K/AKT pathway. In addition, coligation of PDCD1 inhibits BCR-mediating signal by dephosphorylating key signal transducer. PDCD1 has been suggested to be involved in lymphocyte clonal selection and peripheral tolerance, and thus contributes to the prevention of autoimmune diseases. As a cell surface molecule, PDCD1 regulates the adaptive immune response. Engagement of PD-1 by its ligands PD-L1 or PD-L2 transduces a signal that inhibits T-cell proliferation, cytokine production, and cytolytic function.Enter the section text here
| Source | Human Cells
|
| Description | Recombinant Cynomolgus monkey Programmed Cell Death Protein 1 is produced by our Mammalian expression system and the target gene encoding Pro21-Gln167 is expressed with a 6His tag at the C-terminus.
|
| Names | Programmed cell death 1, PD-1, PD1
|
| Accession # | B0LAJ3
|
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
|
| Shipping | The product is shipped at ambient temperature.
|
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
|
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
|
| Purity | Greater than 95% as determined by reducing SDS-PAGE.
|
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
|
| Amino Acid Sequence | PGWFLESPDRPWNAPTFSPALLLVTEGDNATFTCSFSNASESFVLNWYRMSPSNQTDKLAAFPED RSQPGQDCRFRVTRLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE VPTAHPSPSPRPAGQFQHHHHHH |