Tested Species Reactivity:HumanPredicted Species Reactivity:Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, RatProduct Format:Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.Clonality:PolyclonalHost:RabbitApplication:WBReconstitution and Storage:For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.Gene Symbol:RASL12Official Gene Full Name:RAS-like, family 12NCBI Gene Id:51285Protein Name:Ras-like protein family member 12Swissprot Id:Q9NYN1Protein Accession #:NP_057647Nucleotide Accession #:NM_016563Alias Symbols:RISReplacement Item:This antibody may replace item sc-137708 from Santa Cruz Biotechnology.Description of Target:The function of this protein remains unknown.Protein Size (# AA):266Molecular Weight:30kDaPurification:Affinity PurifiedTissue Tool:Find tissues and cell lines supported by DNA array analysis to express RASL12. 
RNA Seq:Find tissues and cell lines supported by RNA-seq analysis to express RASL12. 
Immunogen:The immunogen is a synthetic peptide directed towards the N terminal region of human RASL12Predicted Homology Based on Immunogen Sequence:Cow: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%Complete computational species homology data:Anti-RASL12 (ARP56945_P050)Peptide Sequence:Synthetic peptide located within the following region: MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYDConcentration:Batch dependent within range: 100 ul at 0.5 - 1 mg/mlProtein Interactions:APP; SMURF2; BMPR1B; SMAD3; SMAD1; SMAD2; SMAD4; TGFBR1; ACVR1;Blocking Peptide:For anti-RASL12 (ARP56945_P050) antibody is Catalog # AAP56945 (Previous Catalog # AAPP39134)Datasheets/Manuals:Printable datasheet for anti-RASL12 (ARP56945_P050) antibody